Germany
Japan
United Kingdom
China
Rabbit Polyclonal IRTA2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Antibodies
View as table Download
Rabbit polyclonal anti-FCRL5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FCRL5. |
Rabbit Polyclonal Anti-FCRL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FCRL5 antibody is: synthetic peptide directed towards the C-terminal region of Human FCRL5. Synthetic peptide located within the following region: ALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYHNVPAWEELQPVYTNA |
IRTA2 (FCRL5) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 301-331 amino acids from the Central region of human FCRL5 |
FCRL5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 16-190 of human FCRL5 (NP_001182317.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- FCRL5