Rabbit Polyclonal Anti-FCRL6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FCRL6 antibody: synthetic peptide directed towards the middle region of human FCRL6. Synthetic peptide located within the following region: LRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQ |
Rabbit Polyclonal Anti-FCRL6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FCRL6 antibody is: synthetic peptide directed towards the C-terminal region of Human FCRL6. Synthetic peptide located within the following region: HSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVL |
Germany
Japan
United Kingdom
China