Rabbit Polyclonal Anti-FCRLA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FCRLA antibody: synthetic peptide directed towards the middle region of human FCRLA. Synthetic peptide located within the following region: PTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYH |
Rabbit Polyclonal Anti-FCRLA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FCRLA antibody: synthetic peptide directed towards the C terminal of human FCRLA. Synthetic peptide located within the following region: MPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRKPGTTKATAE |
FCRLA rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FCRLA |
Germany
Japan
United Kingdom
China
