Antibodies

Jump to Filters
View as table Download
Fetuin B (FETUB) Rabbit Polyclonal Antibody
TA346483

USD 475.00

5 Days

Rabbit Polyclonal Anti-FETUB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FETUB antibody: synthetic peptide directed towards the N terminal of human FETUB. Synthetic peptide located within the following region: GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL
Fetuin B (FETUB) Rabbit Polyclonal Antibody
TA349975

USD 345.00

In Stock

Rabbit Polyclonal Anti-FETUB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human FETUB