Rabbit Polyclonal Anti-FEV Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FEV antibody: synthetic peptide directed towards the N terminal of human FEV. Synthetic peptide located within the following region: PLSPAVQKGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVA |
Rabbit Polyclonal Anti-FEV Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FEV antibody is: synthetic peptide directed towards the C-terminal region of Human FEV. Synthetic peptide located within the following region: AAAAAAAQDGALYKLPAGLAPLPFPGLSKLNLMAASAGVAPAGFSYWPGP |
FEV Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human FEV |
Germany
Japan
United Kingdom
China