Rabbit Polyclonal Anti-FGA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGA antibody: synthetic peptide directed towards the N terminal of human FGA. Synthetic peptide located within the following region: MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS |
Goat Polyclonal Anti-fibrinogen alpha chain (aa123-135) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-fibrinogen alpha chain (aa123-135) Antibody: Peptide with sequence C-RDNTYNRVSEDLR, from the internal region of the protein sequence according to NP_000499.1; NP_068657.1. |
Rabbit Polyclonal Anti-FGA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGA antibody: synthetic peptide directed towards the middle region of human FGA. Synthetic peptide located within the following region: SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAK |
Goat Polyclonal Anti-fibrinogen alpha chain Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-fibrinogen alpha chain Antibody: Peptide with sequence C-STSYNRGDSTFES, from the internal region (near C terminus) of the protein sequence according to NP_000499.1; NP_068657.1. |
Rabbit polyclonal FGA Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 116-144 amino acids from the N-terminal region of human FGA. |
Fibrinogen alpha chain (FGA) Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Fibrinogen alpha chain (Fibrinogen alpha chain (FGA)) (NP_068657.1). |
| Modifications | Unmodified |
Recombinant Anti-D-Dimer (Clone 3B6)
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG3 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-D-Dimer (Clone 3B6)
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
