Germany
Japan
United Kingdom
China
FGF1 rabbit polyclonal antibody, Serum
| Applications | IHC, R, WB |
| Reactivities | Bovine |
| Immunogen | Recombinant Bovine Fibroblast Growth Factor-1 [FGF-1] (= acidic FGF). |
Antibodies
View as table Download
FGF1 rabbit polyclonal antibody, Serum
| Applications | IHC, R, WB |
| Reactivities | Bovine |
| Immunogen | Recombinant Bovine Fibroblast Growth Factor-1 [FGF-1] (= acidic FGF). |
Rabbit Polyclonal Antibody against FGF1 (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 5-30 amino acids from the N-terminal region of human FGF1. |
Rabbit Polyclonal Anti-Fgf1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fgf1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTR |
FGF1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human FGF1 |
Rabbit Polyclonal Anti-Fgf1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Fgf1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ |
Anti-FGF1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1 |
FGF1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 16-155 of human FGF1 (NP_001138364.1). |
| Modifications | Unmodified |
FGF1 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- FGF1