Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
FGF2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FGF2 |
FGF2 mouse monoclonal antibody, clone F-474, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FGF2 mouse monoclonal antibody, clone F-343, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FGF2 mouse monoclonal antibody, clone F-3, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FGF2 mouse monoclonal antibody, clone F-74, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FGF2 mouse monoclonal antibody, clone KT1, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
FGF2 mouse monoclonal antibody, clone KT1, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
FGF2 mouse monoclonal antibody, clone KT1, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
Rabbit polyclonal anti-FGF-2 antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant rat FGF-2 |
Anti-FGF2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 215-229 amino acids of Human Fibroblast growth factor 2 |
FGF2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 143-288 of human FGF2 (NP_001997.5). |
| Modifications | Unmodified |
FGF2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FGF2. |
bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
bFGF (FGF2) mouse monoclonal antibody, clone OTI2H11 (formerly 2H11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
bFGF (FGF2) mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
| Applications | FC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
Rabbit polyclonal anti-FGF2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FGF2 |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Germany
Japan
United Kingdom
China
