Antibodies

Jump to Filters
View as table Download
FGL2 Rabbit Polyclonal Antibody
TA340132

USD 375.00

5 Days

Rabbit Polyclonal Anti-FGL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGL2 antibody: synthetic peptide directed towards the middle region of human FGL2. Synthetic peptide located within the following region: WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
FGL2 Rabbit Polyclonal Antibody
TA349982

USD 345.00

In Stock

Rabbit Polyclonal Anti-FGL2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FGL2
FGL2 Rabbit Polyclonal Antibody
TA364799

USD 380.00

4 Weeks

FGL2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FGL2
FGL2 Rabbit Polyclonal Antibody
TA376244

USD 220.00

3 Weeks

FGL2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-140 of human FGL2 (NP_006673.1).
Modifications Unmodified