Antibodies

View as table Download

Rabbit Polyclonal Anti-FHL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-FHL1 Antibody: synthetic peptide directed towards the C terminal of human FHL1. Synthetic peptide located within the following region: YYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCS

FHL1 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human FHL1

Goat Polyclonal Antibody against FHL1 / SLIM1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence CNKRFVFHNEQVY, from the internal region of the protein sequence according to NP_001440.

Goat Polyclonal Antibody against SLIMMER / FHL1 isoform B

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CTVSRVSHPVSKARK, from the internal region of the protein sequence according to AAC72886.1.

Rabbit Polyclonal anti-FHL1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FHL1 antibody: synthetic peptide corresponding to a region of Human. Synthetic peptide located within the following region: SKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPK

Carrier-free (BSA/glycerol-free) FHL1 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FHL1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FHL1 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FHL1 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FHL1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-FHL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FHL1

FHL1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FHL1

FHL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-296 of human FHL1 (NP_001153171.1).
Modifications Unmodified

FHL1 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)

Applications FC, IF, WB
Reactivities Human, Dog, Rat, Mouse
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

FHL1 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11), Biotinylated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Biotin

FHL1 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation HRP

FHL1 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-FHL1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FHL1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-FHL1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FHL1 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Anti-FHL1 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6), HRP conjugated

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-FHL1 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FHL1 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FHL1 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

FHL1 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FHL1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FHL1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-FHL1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated