Rabbit Polyclonal Anti-FHL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FHL1 Antibody: synthetic peptide directed towards the C terminal of human FHL1. Synthetic peptide located within the following region: YYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCS |
FHL1 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human FHL1 |
Goat Polyclonal Antibody against FHL1 / SLIM1
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CNKRFVFHNEQVY, from the internal region of the protein sequence according to NP_001440. |
Goat Polyclonal Antibody against SLIMMER / FHL1 isoform B
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CTVSRVSHPVSKARK, from the internal region of the protein sequence according to AAC72886.1. |
Rabbit Polyclonal anti-FHL1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FHL1 antibody: synthetic peptide corresponding to a region of Human. Synthetic peptide located within the following region: SKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPK |
FHL1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FHL1 |
FHL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 27-296 of human FHL1 (NP_001153171.1). |
| Modifications | Unmodified |
FHL1 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Anti-FHL1 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
| Applications | FC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
Germany
Japan
United Kingdom
China
