Antibodies

View as table Download

FKBP2 (N-term) rabbit polyclonal antibody

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 19~48 amino acids from the N-terminal region of human FKBP2

Rabbit Polyclonal Anti-FKBP2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FKBP2 antibody: synthetic peptide directed towards the N terminal of human FKBP2. Synthetic peptide located within the following region: RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV

FKBP2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-142 of human FKBP2 (NP_004461.2).
Modifications Unmodified