FKBP2 (N-term) rabbit polyclonal antibody
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 19~48 amino acids from the N-terminal region of human FKBP2 |
FKBP2 (N-term) rabbit polyclonal antibody
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 19~48 amino acids from the N-terminal region of human FKBP2 |
Rabbit Polyclonal Anti-FKBP2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FKBP2 antibody: synthetic peptide directed towards the N terminal of human FKBP2. Synthetic peptide located within the following region: RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV |
FKBP2 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-142 of human FKBP2 (NP_004461.2). |
Modifications | Unmodified |