Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal FKBP51 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FKBP51 antibody: mouse FKBP51 (FK506 Binding Protein 51), using two KLH-conjugated synthetic peptides containing an amino acid sequence from the central part of the protein |
Rabbit Polyclonal Anti-FKBP5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FKBP5 antibody: synthetic peptide directed towards the C terminal of human FKBP5. Synthetic peptide located within the following region: CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE |
Rabbit Polyclonal Anti-FKBP5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FKBP5 antibody is: synthetic peptide directed towards the middle region of Human FKBP5. Synthetic peptide located within the following region: KMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESW |
FKBP5 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FKBP5 |
FKBP5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FKBP5 |
FKBP5 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FKBP5 |
FKBP51/FKBP5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 308-457 of human FKBP51/FKBP51/FKBP51/FKBP5 (NP_001139247.1). |
| Modifications | Unmodified |
FKBP51 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human FKBP51 |
Anti-FKBP5 (FKBP51) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- FKBP5