Antibodies

View as table Download

Rabbit anti-FLI1 Polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human FLI1

Rabbit polyclonal anti-FLI1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human FLI1.

Rabbit Polyclonal Anti-FLI1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the middle region of human FLI1. Synthetic peptide located within the following region: FDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMP

Rabbit Polyclonal Anti-FLI1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FLI1 Antibody: A synthesized peptide derived from human FLI1

Rabbit Polyclonal FLI1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen FLI1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human FLI1. The immunogen is located within the last 50 amino acids of FLI1 .

FLI1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the Center region of human FLI1

FLI1 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human FLI1

Rabbit Polyclonal Anti-FLI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the N terminal of human FLI1. Synthetic peptide located within the following region: TASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCS

Rabbit Polyclonal Anti-FLI1 Antibody

Applications WB
Reactivities Human, Porcine
Conjugation Unconjugated
Immunogen The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the N terminal of human FLI1. Synthetic peptide located within the following region: MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINP

Rabbit Polyclonal Anti-FLI1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FLI1

FLI1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human FLI1

FLI1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FLI1

FLI1 (1G5) Mouse monoclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

FLI1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human FLI1