Antibodies

Jump to Filters
View as table Download
Fibromodulin (FMOD) (C-term) Rabbit Polyclonal Antibody
AP51689PU-N

USD 450.00

2 Weeks

Fibromodulin (FMOD) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 343~373 amino acids from the C-terminal region of Human Fibromodulin.
Fibromodulin (FMOD) Rabbit Polyclonal Antibody
TA335029

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-FMOD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FMOD antibody: synthetic peptide directed towards the N terminal of human FMOD. Synthetic peptide located within the following region: VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER
Fibromodulin (FMOD) Rabbit Polyclonal Antibody
TA376299

USD 220.00

3 Weeks

FMOD Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-376 of human FMOD (NP_002014.2).
Modifications Unmodified