FNDC3B (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-term region of human FNDC3B |
FNDC3B (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-term region of human FNDC3B |
Rabbit Polyclonal Anti-FNDC3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FNDC3B antibody: synthetic peptide directed towards the N terminal of human FNDC3B. Synthetic peptide located within the following region: RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP |
FNDC3B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
FNDC3B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |