Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-FOXH1 antibody
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FOXH1. |
Rabbit polyclonal anti-FoxH1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 55 of mouse FoxH1 |
Rabbit Polyclonal Anti-FOXH1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXH1 antibody: synthetic peptide directed towards the middle region of mouse FOXH1. Synthetic peptide located within the following region: GPSSSSETPLWPLCSLPGPTIIEGESSQGEVIRPSPVTPDQGSWPLHLLE |
Rabbit Polyclonal Anti-FOXH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXH1 antibody: synthetic peptide directed towards the N terminal of human FOXH1. Synthetic peptide located within the following region: MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAP |
Active filters
Target Symbol
- FOXH1