Rabbit Polyclonal Anti-FOXJ3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXJ3 antibody: synthetic peptide directed towards the middle region of human FOXJ3. Synthetic peptide located within the following region: IPQALSTPGTTMAGHHRAMNQQHMMPSQAFQMRRSLPPDDIQDDFDWDSI |
Rabbit polyclonal anti-FOXJ3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FOXJ3. |
Rabbit Polyclonal anti-Foxj3 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Foxj3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VTLYNADQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTNHPEP |
Rabbit Polyclonal Anti-FOXJ3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXJ3 antibody: synthetic peptide directed towards the middle region of human FOXJ3. Synthetic peptide located within the following region: TKPSQHIGTGNLYIDSRQNLPPSVMPPPGYPHIPQALSTPGTTMAGHHRA |
Anti-FOXJ3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 610-622 amino acids of Human forkhead box J1 |
FOXJ3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human FOXJ3 |
Germany
Japan
United Kingdom
China
