Germany
Japan
United Kingdom
China
Rabbit anti-FOXP2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FOXP2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-FOXP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXP2 Antibody: Peptide sequence around aa.707~711(E-E-P-L-S) derived from Human FOXP2. |
Rabbit polyclonal FOXP2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This FOXP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 657-684 amino acids from the C-terminal region of human FOXP2. |
Rabbit Polyclonal Anti-FOXP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXP2 antibody: synthetic peptide directed towards the N terminal of human FOXP2. Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA |
Rabbit Polyclonal Anti-FOXP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXP2 antibody: synthetic peptide directed towards the N terminal of human FOXP2. Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA |
Goat Polyclonal Antibody against FOXP2 (Internal region)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEVEYQKRRSQKIT, from the internal region of the protein sequence according to NP_055306.1; NP_683696.1; NP_683697.1; NP_683698.1. |
Rabbit anti FOXP2 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal region of human FOXP2 protein. This sequence is identical to human, mouse, rat and dog. |
Anti-FOXP2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 701-715 amino acids of Human forkhead box P2 |
FOXP2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP2 |
Recombinant Anti-FOXP2 (Clone RAB-S249)
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | His Tag |
Recombinant Anti-FOXP2 (Clone RAB-S249)
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- FOXP2