Antibodies

View as table Download

Rabbit Polyclonal Anti-FOXR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXR1 antibody: synthetic peptide directed towards the N terminal of human FOXR1. Synthetic peptide located within the following region: KKPNPDKDGPDYEPNLWMWVNPNIVYPPGKLEVSGRRKREDLTSTLPSSQ

Carrier-free (BSA/glycerol-free) FOXR1 mouse monoclonal antibody,clone OTI3D8

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FOXR1 mouse monoclonal antibody,clone OTI5A5

Applications WB
Reactivities Human
Conjugation Unconjugated

FOXR1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of human FOXR1

FOXR1 mouse monoclonal antibody,clone OTI3D8

Applications WB
Reactivities Human
Conjugation Unconjugated

FOXR1 mouse monoclonal antibody,clone OTI3D8, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

FOXR1 mouse monoclonal antibody,clone OTI3D8

Applications WB
Reactivities Human
Conjugation Unconjugated

FOXR1 mouse monoclonal antibody,clone OTI5A5

Applications WB
Reactivities Human
Conjugation Unconjugated

FOXR1 mouse monoclonal antibody,clone OTI5A5, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

FOXR1 mouse monoclonal antibody,clone OTI5A5

Applications WB
Reactivities Human
Conjugation Unconjugated