Antibodies

Jump to Filters
View as table Download
FRMPD2 Rabbit Polyclonal Antibody
TA306863

USD 430.00

5 Days

Rabbit Polyclonal FRMPD2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen FRMPD2 antibody was raised against a 15 amino acid peptide from near the amino terminus of human FRMPD2.
FRMPD2 Rabbit Polyclonal Antibody
TA332255

USD 375.00

5 Days

Rabbit Polyclonal Anti-FRMPD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FRMPD2 Antibody is: synthetic peptide directed towards the N-terminal region of Human FRMPD2. Synthetic peptide located within the following region: LLQGQSEDEQPDASQMHVYSLGMTLYWSAGFHVPPHQPLQLCEPLHSILL