Rabbit Polyclonal Anti-C9orf4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C9orf4 antibody: synthetic peptide directed towards the N terminal of human C9orf4. Synthetic peptide located within the following region: PAACAASPADDGAGPGGRGPRGRARGDTGADEAVPRHDSSYGTFAGEFYD |
Rabbit Polyclonal Anti-C9orf4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C9orf4 antibody: synthetic peptide directed towards the middle region of human C9orf4. Synthetic peptide located within the following region: HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP |
Germany
Japan
United Kingdom
China