Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-FSCN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FSCN1 |
Fascin (FSCN1) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human Fascin |
Rabbit polyclonal antibody to Fascin (fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 162 and 386 of Fascin 1 (Uniprot ID#Q16658) |
Rabbit Polyclonal Anti-Fscn1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fscn1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQSVSPAEKWSVHIAMHPQV |
Carrier-free (BSA/glycerol-free) FSCN1 mouse monoclonal antibody,clone OTI2C3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Fascin Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Fascin Mouse Monoclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Fascin/FSCN1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-380 of human Fascin/Fascin/FSCN1 (NP_003079.1). |
| Modifications | Unmodified |
Fascin/FSCN1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 394-493 of human Fascin/Fascin/FSCN1 (NP_003079.1). |
| Modifications | Unmodified |
Fascin Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Fascin |
Recombinant Anti-FSCN1 (Clone SAIC-32C-205)
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-Fascin (Ser-39), Phosphospecific Antibody
| Applications | IHC, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
FSCN1 mouse monoclonal antibody,clone OTI2C3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FSCN1 mouse monoclonal antibody,clone OTI2C3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
FSCN1 mouse monoclonal antibody,clone OTI2C3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
FSCN1 mouse monoclonal antibody,clone OTI2C3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
FSCN1 mouse monoclonal antibody,clone OTI3D2
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- FSCN1