Antibodies

Jump to Filters
View as table Download
Fascin 2 (FSCN2) Goat Polyclonal Antibody
AP31070PU-N

USD 375.00

5 Days

Fascin 2 (FSCN2) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Canine, Human, Mouse, Rat
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_001070650.1; NP_036550.1.
Fascin 2 (FSCN2) Rabbit Polyclonal Antibody
TA342740

USD 375.00

5 Days

Rabbit Polyclonal Anti-FSCN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FSCN2 antibody: synthetic peptide directed towards the middle region of human FSCN2. Synthetic peptide located within the following region: AGTLKAGRNTRPGKDELFDLEESHPQVVLVAANHRYVSVRQGVNVSANQD
Fascin 2 (FSCN2) Rabbit Polyclonal Antibody
TA376360

USD 220.00

3 Weeks

FSCN2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-310 of human FSCN2 (NP_036550.1).
Modifications Unmodified