Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against FSTL1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TAEKTKRVSTKEI, from the C Terminus of the protein sequence according to NP_009016.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-FSTL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FSTL1 antibody: synthetic peptide directed towards the C terminal of human FSTL1. Synthetic peptide located within the following region: LNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKN |
FSTL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FSTL1 |
FSTL1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-308 of human FSTL1 (NP_009016.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- FSTL1