Mouse Anti-FTO ( Fat mass and obesity related protein) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Anti-FTO ( Fat mass and obesity related protein) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal FTO Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | FTO antibody was raised against a 15 amino acid synthetic peptide from near the amino terminus of human FTO. The immunogen is located within the first 50 amino acids of FTO. |
FTO (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human FTO |
Goat Anti-FTO (Mouse) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence QQKPDCRPYWEKDD, from the Internal region of the protein sequence according to NP_036066.2. |
Rabbit Polyclonal FTO Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide within the C-terminal region (residues 400-505) of the human FTO protein. [Swiss-Prot# Q9C0B1] |
Rabbit Polyclonal Anti-Fto Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fto antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV |
Rabbit Polyclonal Anti-FTO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FTO antibody: synthetic peptide directed towards the middle region of human FTO. Synthetic peptide located within the following region: WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA |
Carrier-free (BSA/glycerol-free) FTO mouse monoclonal antibody,clone OTI4A1
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FTO Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FTO |
FTO rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FTO |
FTO Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 416-505 of human FTO (NP_001073901.1). |
| Modifications | Unmodified |
FTO Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FTO. |
FTO Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human FTO. AA range:19-68 |
FTO Rabbit monoclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FTO mouse monoclonal antibody,clone OTI4A1
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
FTO mouse monoclonal antibody,clone OTI4A1, Biotinylated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
FTO mouse monoclonal antibody,clone OTI4A1, HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
FTO mouse monoclonal antibody,clone OTI4A1
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |