Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-FUBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUBP1 antibody: synthetic peptide directed towards the middle region of human FUBP1. Synthetic peptide located within the following region: YYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEY |
Rabbit polyclonal FUBP1 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This FUBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 240-268 amino acids from the Central region of human FUBP1. |
Rabbit polyclonal Anti-FUBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUBP1 antibody: synthetic peptide directed towards the N terminal of human FUBP1. Synthetic peptide located within the following region: IGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEM |
Rabbit Polyclonal Anti-FUBP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUBP1 antibody: synthetic peptide directed towards the N terminal of human FUBP1. Synthetic peptide located within the following region: QIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQL |
FUBP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FUBP1 |
FUBP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 302-644 of human FUBP1 (NP_003893.2). |
| Modifications | Unmodified |
FUBP1 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 302-644 of human FUBP1 (NP_003893.2). |
| Modifications | Unmodified |
FUBP1 Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- FUBP1