Rabbit Polyclonal Anti-FUNDC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUNDC1 antibody: synthetic peptide directed towards the N terminal of human FUNDC1. Synthetic peptide located within the following region: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV |
Rabbit Polyclonal Anti-FUNDC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUNDC1 antibody: synthetic peptide directed towards the middle region of human FUNDC1. Synthetic peptide located within the following region: TAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINN |
FUNDC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human FUNDC1 (NP_776155.1). |
Germany
Japan
United Kingdom
China
