Antibodies

Jump to Filters
View as table Download
FXYD1 Rabbit Polyclonal Antibody
TA339439

USD 375.00

5 Days

Rabbit Polyclonal Anti-FXYD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FXYD1 antibody: synthetic peptide directed towards the N terminal of human FXYD1. Synthetic peptide located within the following region: ASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILG
FXYD1 Rabbit Polyclonal Antibody
TA349652

USD 345.00

In Stock

Rabbit Polyclonal Anti-FXYD1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FXYD1
FXYD1 Rabbit Polyclonal Antibody
TA364664

USD 380.00

4 Weeks

FXYD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FXYD1
FXYD1 Rabbit Polyclonal Antibody
TA376400

USD 220.00

3 Weeks

FXYD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-92 of human FXYD1 (NP_005022.2).
Modifications Unmodified