Antibodies

View as table Download

Rabbit Polyclonal Anti-FZD4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV

Anti-FZD4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 37-222 amino acids of human frizzled family receptor 4

Goat Polyclonal Antibody against FZD4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence DEEERRCDPIRIS, from the internal region of the protein sequence according to NP_036325.2.

Rabbit polyclonal anti-FZD4 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD4.

Frizzled 4 (FZD4) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 501~531 amino acids from the C-terminal region of Human CD344 / FZD4 / Frizzled-4

Rabbit polyclonal anti-FZD4 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD4.

Goat Anti-FZD4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KIRSNLQKDGTKT, from the internal region of the protein sequence according to NP_036325.2.

Anti-FZD4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 37-222 amino acids of human frizzled family receptor 4

FZD4 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human FZD4

FZD4 Antibody - C-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse FZD4

FZD4 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 37-222 of human FZD4 (NP_036325.2).
Modifications Unmodified