Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Goat Polyclonal Antibody against FZD7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RFYHRLSHSSKGET, from the C Terminus of the protein sequence according to NP_003498.1. |
FZD7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human FZD7 (NP_003498.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
