Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: TRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGS |
Rabbit polyclonal anti-FZD9 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human FZD9. |
Rabbit Polyclonal Anti-FZD9 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | FZD9 / Frizzled 9 antibody was raised against synthetic 14 amino acid peptide from 1st extracellular domain of human FZD9 / Frizzled 9. Percent identity with other species by BLAST analysis: Human, Gibbon, Mouse, Rat, Hamster, Panda, Dog, Bovine, Bat, Rabbit, Opossum (100%); Platypus (86%). |
Rabbit Polyclonal Anti-FZD9 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | FZD9 / Frizzled 9 antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human FZD9 / Frizzled 9. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Mouse, Rat, Bovine (93%). |
FZD9 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 469-591 of human FZD9 (NP_003499.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
