Germany
Japan
United Kingdom
China
BLBP (FABP7) mouse monoclonal antibody, clone AT1D1, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
Antibodies
View as table Download
BLBP (FABP7) mouse monoclonal antibody, clone AT1D1, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
Rabbit Polyclonal Anti-FABP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FABP7 antibody: synthetic peptide directed towards the N terminal of human FABP7. Synthetic peptide located within the following region: NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF |
FABP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FABP7 Antibody
| Applications | WB |
| Conjugation | Unconjugated |
FABP7 Antibody
| Applications | WB |
| Conjugation | Unconjugated |
FABP7 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse FABP7 |
FABP7 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human FABP7 (NP_001437.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- FABP7