Antibodies

Jump to Filters
View as table Download
C9orf25 (FAM219A) Rabbit Polyclonal Antibody
TA329767

USD 375.00

5 Days

Rabbit polyclonal Anti-C9orf25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C9orf25 antibody: synthetic peptide directed towards the middle region of human C9orf25. Synthetic peptide located within the following region: SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC
Fam219a Rabbit Polyclonal Antibody
TA357244

USD 360.00

5 Days

2310028H24Rik Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated