Rabbit Polyclonal Anti-FAM76A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAM76A antibody: synthetic peptide directed towards the N terminal of human FAM76A. Synthetic peptide located within the following region: MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESK |
Rabbit Polyclonal Anti-FAM76A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAM76A antibody: synthetic peptide directed towards the middle region of human FAM76A. Synthetic peptide located within the following region: QCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQE |
Germany
Japan
United Kingdom
China