Antibodies

View as table Download

Rabbit Polyclonal Anti-FBLN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBLN1 antibody: synthetic peptide directed towards the N terminal of human FBLN1. Synthetic peptide located within the following region: CCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRD

Rabbit Polyclonal Anti-Fbln1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Fbln1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Fbln1. Synthetic peptide located within the following region: FTRPEEIIFLRAVTPLYPANQADIIFDITEGNLRDSFDIIKRYEDGMTVG

Fibulin 1 (FBLN1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 622-650 amino acids from the C-terminal region of Human Fibulin-1.

Anti-FBLN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 159-172 amino acids of Human fibulin 1

Anti-FBLN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 159-173 amino acids of Human fibulin 1

FBLN1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 570-670 of human FBLN1 (NP_001987.2).
Modifications Unmodified