Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Ferredoxin Reductase (FDXR) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 458-487 amino acids from the C-terminal region of human FDXR |
Rabbit Polyclonal Anti-FDXR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FDXR antibody: synthetic peptide directed towards the middle region of human FDXR. Synthetic peptide located within the following region: LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW |
FDXR Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FDXR rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FDXR |
FDXR Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 252-491 of human FDXR (NP_077728.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- FDXR