Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-FGF11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF11 antibody is: synthetic peptide directed towards the N-terminal region of Human FGF11. Synthetic peptide located within the following region: LASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLC |
Rabbit Polyclonal Anti-FGF11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF11 antibody: synthetic peptide directed towards the N terminal of human FGF11. Synthetic peptide located within the following region: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKL |
FGF11 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human FGF11. AA range:21-70 |
Active filters
Target Symbol
- FGF11