Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-FGF13 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FGF13. |
Rabbit Polyclonal Anti-FGF13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FGF13 Antibody: synthetic peptide directed towards the middle region of human FGF13. Synthetic peptide located within the following region: PKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST |
Goat Anti-FGF13 (isoform 1) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KGKTSCDKNKLNVFS, from the internal region of the protein sequence according to NP_004105.1. |
Rabbit Polyclonal Anti-FGF13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FGF13 Antibody: synthetic peptide directed towards the middle region of human FGF13. Synthetic peptide located within the following region: TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK |
Carrier-free (BSA/glycerol-free) FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
FGF13 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse FGF13 |
FGF13 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FGF13 |
FGF13 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FGF13 |
FGF13 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human FGF13 (NP_004105.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- FGF13