Rabbit Polyclonal Anti-Fgf3 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fgf3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KGRPRRGFKTRRTQKSSLFLPRVLGHKDHEMVRLLQSGQPQAPGEGSQPR |
Mouse monoclonal Anti-FGF3 Clone MSD1
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
FGF3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF3 (NP_005238.1). |
Germany
Japan
United Kingdom
China
