Antibodies

View as table Download

Rabbit Polyclonal FMNL2 Antibody

Applications IHC, WB
Reactivities Human, Rat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 1-50 of human Formin-like protein 2 was used as the immunogen.

Rabbit Polyclonal Anti-FMNL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FMNL2 antibody is: synthetic peptide directed towards the middle region of Human FMNL2. Synthetic peptide located within the following region: RFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQ

Rabbit Polyclonal Anti-FMNL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FMNL2 antibody: synthetic peptide directed towards the N terminal of human FMNL2. Synthetic peptide located within the following region: MGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKAR

FMNL2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FMNL2

FMNL2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FMNL2