FOXK2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FOXK2 |
FOXK2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FOXK2 |
Rabbit Polyclonal Anti-FOXK2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXK2 antibody: synthetic peptide directed towards the middle region of human FOXK2. Synthetic peptide located within the following region: GTASRIIQTAQTTPVQTVTIVQQAPLGQHQLPIKTVTQNGTHVASVPTAV |
Rabbit Polyclonal Anti-FOXK2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXK2 antibody: synthetic peptide directed towards the C terminal of human FOXK2. Synthetic peptide located within the following region: DKQLTLNGIYTHITKNYPYYRTADKGWQRGESFAHVGNTRIRIGLPAHKA |
Rabbit Polyclonal Anti-FOXK2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXK2 antibody: synthetic peptide directed towards the middle region of human FOXK2. Synthetic peptide located within the following region: ANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG |
Goat Polyclonal Antibody against FOXK2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TPPAAVREKGVQN, from the C Terminus of the protein sequence according to NP_004505. |
Rabbit Polyclonal Anti-FOXK2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXK2 antibody: synthetic peptide directed towards the C terminal of human FOXK2. Synthetic peptide located within the following region: SASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVREKGVQN |
Rabbit Polyclonal Anti-FOXK2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXK2 antibody: synthetic peptide directed towards the middle region of human FOXK2. Synthetic peptide located within the following region: ASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVREKGVQN |
FOXK2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of HUMAN FOXK2 |
FOXK2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
FOXK2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FOXK2 |
FOXK2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 511-660 of human FOXK2 (NP_004505.2). |
Modifications | Unmodified |