Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-FOXN4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FOXN4. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-FOXN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXN4 antibody: synthetic peptide directed towards the C terminal of human FOXN4. Synthetic peptide located within the following region: HHQVQPQAHLAPDSPAPAQTPPLHALPDLSPSPLPHPAMGRAPVDFINIS |
Rabbit Polyclonal Anti-FOXN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXN4 antibody: synthetic peptide directed towards the middle region of human FOXN4. Synthetic peptide located within the following region: QGNLWEEMKDEGFSLDTLGAFADSPLGCDLGASGLTPASGGSDQSFPDLQ |
Active filters
Target Symbol
- FOXN4