Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Foxp3 mouse monoclonal antibody, clone 3G3, Aff - Purified
| Applications | FC, WB |
| Reactivities | Human, Mouse |
Rabbit Polyclonal Anti-FOXP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXP3 antibody: synthetic peptide directed towards the N terminal of human FOXP3. Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL |
Mouse Monoclonal FOXP3 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
beta Catenin (CTNNB1) rabbit monoclonal antibody, clone E247, Supernatant
| Applications | IHC |
| Reactivities | Human |
alpha 1 Fetoprotein (AFP) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Human Alpha-Fetoprotein purified from Human cord serum |
Rabbit Polyclonal Antibody against FOXP3
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human FOXP3 (between residues 1-50). |
Rabbit Polyclonal Anti-Foxp3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Foxp3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Foxp3. Synthetic peptide located within the following region: LPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPT |
Mouse Monoclonal FOXP3 Delta 2 (exon 2 deleted) specific Antibody (16J4G6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti FOXP3 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human FOXP3 protein. This sequence is identical within human, mouse, rat origins. |
Carrier-free (BSA/glycerol-free) FOXP3 mouse monoclonal antibody,clone OTI8H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOXP3 mouse monoclonal antibody,clone OTI3H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOXP3 mouse monoclonal antibody,clone OTI8D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOXP3 mouse monoclonal antibody,clone OTI6B10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-FOXP3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 410-424 amino acids of Human forkhead box P3 |
FOXP3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human FOXP3 (NP_054728.2). |
| Modifications | Unmodified |
FOXP3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-300 of human FOXP3 (NP_001107849.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
FOXP3 mouse monoclonal antibody,clone OTI8H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FOXP3 mouse monoclonal antibody,clone OTI8H4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
FOXP3 mouse monoclonal antibody,clone OTI8H4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
FOXP3 mouse monoclonal antibody,clone OTI8H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FOXP3 mouse monoclonal antibody,clone OTI3H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FOXP3 mouse monoclonal antibody,clone OTI3H2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
FOXP3 mouse monoclonal antibody,clone OTI3H2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
FOXP3 mouse monoclonal antibody,clone OTI3H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
FOXP3 mouse monoclonal antibody,clone OTI8D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FOXP3 mouse monoclonal antibody,clone OTI8D6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
FOXP3 mouse monoclonal antibody,clone OTI8D6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
FOXP3 mouse monoclonal antibody,clone OTI8D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
FOXP3 mouse monoclonal antibody,clone OTI6B10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
