Rabbit Polyclonal Anti-FRZB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FRZB antibody: synthetic peptide directed towards the N terminal of human FRZB. Synthetic peptide located within the following region: HSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPC |
Rabbit Polyclonal Anti-FRZB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FRZB antibody: synthetic peptide directed towards the middle region of human FRZB. Synthetic peptide located within the following region: VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERS |
FRZB Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse FRZB |
FRZB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 166-325 of human FRZB (NP_001454.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China