Rabbit Polyclonal Anti-GABA(A) alpha4 (extracellular)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSKDEKLSPENFTR(C), corresponding to amino acid residues 37-50 of rat GABA(A) a4 with replacement of C44 with serine. Extracellular, N-terminus. |
Rabbit polyclonal anti-GABRA4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GABRA4. |
Goat Anti-GABRA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKAKRKTSKPPQE, from the internal region of the protein sequence according to NP_000800.2. |
Rabbit Polyclonal Anti-GABRA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRA4 antibody: synthetic peptide directed towards the N terminal of human GABRA4. Synthetic peptide located within the following region: MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTR |
GABRA4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 36-258 of human GABRA4 (NP_000800.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
