Antibodies

Jump to Filters
View as table Download
Galanin (GAL) Rabbit Polyclonal Antibody
TA371800

USD 380.00

4 Weeks

GAL rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAL
Galanin (GAL) (Center) Rabbit Polyclonal Antibody
AP51760PU-N

USD 450.00

2 Weeks

Galanin (GAL) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 55-86 amino acids from the Central region of human GAL
Galanin (GAL) Rabbit Polyclonal Antibody
TA364094

USD 400.00

2 Weeks

Rabbit polyclonal anti human Galanin

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein.
Galanin (GAL) Guinea Pig Polyclonal Antibody
TA364389

USD 545.00

2 Weeks

Guinea pig polyclonal anti Galanin (hu); neat antiserum

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein.
Galanin (GAL) Goat Polyclonal Antibody
TA311451

USD 375.00

2 Weeks

Goat Anti-GAL Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-HRSFSDKNGLTSK, from the internal region of the protein sequence according to NP_057057.2.
Galanin (GAL) Rabbit Polyclonal Antibody
TA330441

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-GAL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAL antibody: synthetic peptide directed towards the middle region of human GAL. Synthetic peptide located within the following region: LNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENN
Galanin (GAL) Rabbit Polyclonal Antibody
TA364085

USD 690.00

2 Weeks

Rabbit polyclonal anti Galanin (hu); diluted antiserum

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein.
Galanin (GAL) Rabbit Polyclonal Antibody
TA364093

USD 655.00

2 Weeks

Rabbit polyclonal anti Galanin (hu); purified rabbit IgG

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein.
GAL Rabbit Polyclonal Antibody
TA364095

USD 655.00

2 Weeks

Rabbit polyclonal anti Galanin (po); purified rabbit IgG

Applications ELISA
Reactivities Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein.
GAL Rabbit Polyclonal Antibody
TA364096

USD 690.00

2 Weeks

Rabbit polyclonal anti Galanin (po); diluted antiserum

Applications ELISA
Reactivities Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein.
GAL Rabbit Polyclonal Antibody
TA364098

USD 400.00

2 Weeks

Rabbit polyclonal anti Galanin (po); neat antiserum

Applications ELISA
Reactivities Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein.
Gal Rabbit Polyclonal Antibody
TA364099

USD 690.00

2 Weeks

Rabbit polyclonal anti Galanin (ms, rt); diluted antiserum

Applications ELISA
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr- NH2 coupled to carrier protein.
Gal Rabbit Polyclonal Antibody
TA364101

USD 655.00

2 Weeks

Rabbit polyclonal anti Galanin (ms, rt); purified rabbit IgG

Applications ELISA
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr- NH2 coupled to a carrier protein.
GAL Guinea Pig Polyclonal Antibody
TA364388

USD 965.00

2 Weeks

Guinea pig polyclonal anti Galanin (po); diluted antiserum

Applications ELISA
Reactivities Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein.
GAL Guinea Pig Polyclonal Antibody
TA364390

USD 545.00

2 Weeks

Guinea pig polyclonal anti Galanin (porcine) , neat antiserum

Applications ELISA
Reactivities Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein.
GAL Rabbit Polyclonal Antibody
TA367574

USD 380.00

4 Weeks

GAL rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAL
Galanin (GAL) Mouse Monoclonal Antibody [Clone ID: 4B3]
TA385997

USD 523.00

2 Weeks

Recombinant Anti-Galanin (Clone 4B3)

Applications ELISA, ICC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Modifications This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.