Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal GATA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA1 |
Rabbit Polyclonal GATA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA1 |
Rabbit Polyclonal GATA1 (Ser142) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA1 around the phosphorylation site of Serine 142 |
| Modifications | Phospho-specific |
Rabbit Polyclonal GATA1 (Ser310) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA1 around the phosphorylation site of Serine 310 |
| Modifications | Phospho-specific |
Rabbit anti-GATA1 (Phospho-Ser142) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanGATA-1 around the phosphorylation site of serine 142 (R-L-SP-P-D). |
| Modifications | Phospho-specific |
GATA1 pSer142 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
GATA1 pSer310 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
GATA1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
GATA1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Goat Polyclonal Antibody against GATA1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DAEAYRHSPVFQ, from the internal region of the protein sequence according to NP_002040.1. |
Rabbit anti-GATA1 (Phospho-Ser310) polyclonal antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanGATA1 around the phosphorylation site of serine 310 (K-A-SP-G-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GATA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA1 antibody: synthetic peptide directed towards the N terminal of human GATA1. Synthetic peptide located within the following region: SGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCME |
Rabbit anti GATA1(pS142) Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
GATA1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human GATA1 |
| Modifications | Unmodified |
Active filters
Target Symbol
- GATA1