Rabbit Polyclonal Anti-GATA5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA5 antibody: synthetic peptide directed towards the C terminal of mouse GATA5. Synthetic peptide located within the following region: SPTLLNSESSATTLKAESSLASPVCAGPTITSQASSPADESLASSHLEFK |
Goat Polyclonal Antibody against GATA5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ELAARPGWAQTATAD, from the internal region of the protein sequence according to NP_536721.1. |
Rabbit Polyclonal anti-GATA5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA5 antibody: synthetic peptide directed towards the middle region of human GATA5. Synthetic peptide located within the following region: SAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHLEFKFEPEDFAFP |
Gata5 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Germany
Japan
United Kingdom
China
