Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-GATA6 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6. Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS |
Rabbit Polyclonal Anti-GATA6 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the N terminal of human GATA6. Synthetic peptide located within the following region: PEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTR |
Rabbit polyclonal anti-GATA6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human GATA6. |
Mouse Monoclonal GATA6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti GATA-6 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-GATA6 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 9-23 amino acids of Human GATA binding protein 6 |
GATA6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human GATA6 (NP_005248.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
GATA6 Rabbit monoclonal antibody,clone OTIR5F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GATA6 Rabbit monoclonal antibody,clone OTIR5F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GATA6 Rabbit monoclonal antibody,clone OTIR5B8
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
GATA6 Rabbit monoclonal antibody,clone OTIR5B8
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
GATA6 Rabbit monoclonal antibody,clone OTIR3H6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GATA6 Rabbit monoclonal antibody,clone OTIR3H6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- GATA6