Rabbit Polyclonal Anti-GATAD2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATAD2A antibody: synthetic peptide directed towards the N terminal of human GATAD2A. Synthetic peptide located within the following region: RMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPTGSVGSTVTTPPP |
Rabbit Polyclonal Anti-GATAD2A Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATAD2A antibody: synthetic peptide directed towards the N terminal of mouse GATAD2A. Synthetic peptide located within the following region: MSEEACRTRSQKRTLEPDLTEDDVENKKMKMEKGSSELTVDGDSRVMPEP |
GATAD2A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GATAD2A |
Germany
Japan
United Kingdom
China